PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010933247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 241aa    MW: 27969.3 Da    PI: 5.6642
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010933247.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ede+l++ v+q+G g+W+ +++  g++R +k+c++rw +yl
   XP_010933247.1 16 KGPWTAQEDEILIEHVNQHGEGRWNCVSKLTGLRRNGKSCRLRWVNYL 63
                     79********************************************97 PP

2Myb_DNA-binding537.9e-1769113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
   XP_010933247.1  69 RGKITPHEENIILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 113
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7711163IPR017930Myb domain
SuperFamilySSF466898.8E-3013110IPR009057Homeodomain-like
SMARTSM007175.3E-141565IPR001005SANT/Myb domain
PfamPF002493.2E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-221770IPR009057Homeodomain-like
CDDcd001671.58E-91863No hitNo description
PROSITE profilePS5129424.97964118IPR017930Myb domain
SMARTSM007177.8E-1668116IPR001005SANT/Myb domain
PfamPF002493.1E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2471117IPR009057Homeodomain-like
CDDcd001676.84E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEGQFGWGTL ENGWRKGPWT AQEDEILIEH VNQHGEGRWN CVSKLTGLRR NGKSCRLRWV  60
NYLRPDLKRG KITPHEENII LELHALWGNR WSTIARSLPG RTDNEIKNYW RTHFKKSKPL  120
KNIEKARARF LKQQEEQQKS EEEQHQEEQQ QEDMRGIMTQ VEEATLAQDM QEMNYMCPLN  180
YMLQGDGCFG GGCGGRSGSI SDGSSEEEMW GSLWNLDDIH DDREGIRCGA LTMQDQVLAF  240
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25161167106B-MYB
1h8a_C2e-251611727127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933247.11e-180PREDICTED: myb-related protein 340-like
TrEMBLM0RWQ31e-104M0RWQ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P03450_0011e-104(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.14e-67myb domain protein 79